Turok 2: Seeds Of Evil

Strategy Guide

Advertisement

Level select

Enter "DLVTRKBLVL" as a password.

Infinite lives

Enter "DLVTRKBLVS" as a password.

Infinite health

Enter "DLVTRKBNRG" as a password.

All weapons

Enter "DLVTRKBWPS" as a password.

Bird mode

Enter "DLVTRKBBRD" as a password. Then while playing game, hold Select and press A to fly.

Powerful weapons

Enter "QVZLBVSQLV" as a password and play the game on the medium difficulty setting. Intentionally lose all lives, then re-enter the same password. Begin a new game on the easy difficulty setting, then intentionally lose all lives. Begin another new game on the easy difficulty setting, then collect the light burden. Your character will now possess the particle accelerator and the chain gun. Note: Collect the pistol on level 2 to get ammunition for the chain gun.

Alternate end sequence

When the enemy appears in level 9, press Down. After entering the tunnel, shoot the computer and destroy the incubator. Then an alternate ending sequence will begin.

Level passwords

Level
EasyMediumHard
2
DVYLWKVYNLQVYLWKVYDTDLTLWKVYYC
3
GRYLWKWVNRTRYLWKWVNNGNYLWKWVPP
4
DRYLSRWVRYQRYLSRWVTSDNYLSRWVPT
5
GVZLSRWQKZTVZLSRSQKBGLZLSRSVPW
6
DVZLSVQKKQVZLBVSQRLDLZLBVSVVB
7
GRZLBVSQZYTRZLBVBQKBGNZLBVBQVL
8
DRZLBVSQGGQRZLBVBQKSDNZLBVBQVN
9
GVYNBVBQGDTVYNBVBQRLGLYNBVBQQD


Game Shark Codes

Note: You must have a 2.1 or higher version of the Game Shark to use these codes in a Game Boy Color system.

Infinite Lives010AABC1
Infinite Health0163A9C1

Around The Web

Around The Web

X
"Like" CheatCC on Facebook