Turok 2: Seeds Of Evil

Strategy Guide

  • Level select

    Enter "DLVTRKBLVL" as a password.

  • Infinite lives

    Enter "DLVTRKBLVS" as a password.

  • Infinite health

    Enter "DLVTRKBNRG" as a password.

  • All weapons

    Enter "DLVTRKBWPS" as a password.

  • Bird mode

    Enter "DLVTRKBBRD" as a password. Then while playing game, hold Select and press A to fly.

  • Powerful weapons

    Enter "QVZLBVSQLV" as a password and play the game on the medium difficulty setting. Intentionally lose all lives, then re-enter the same password. Begin a new game on the easy difficulty setting, then intentionally lose all lives. Begin another new game on the easy difficulty setting, then collect the light burden. Your character will now possess the particle accelerator and the chain gun. Note: Collect the pistol on level 2 to get ammunition for the chain gun.

  • Alternate end sequence

    When the enemy appears in level 9, press Down. After entering the tunnel, shoot the computer and destroy the incubator. Then an alternate ending sequence will begin.

  • Level passwords

    Level
    EasyMediumHard
    2
    DVYLWKVYNLQVYLWKVYDTDLTLWKVYYC
    3
    GRYLWKWVNRTRYLWKWVNNGNYLWKWVPP
    4
    DRYLSRWVRYQRYLSRWVTSDNYLSRWVPT
    5
    GVZLSRWQKZTVZLSRSQKBGLZLSRSVPW
    6
    DVZLSVQKKQVZLBVSQRLDLZLBVSVVB
    7
    GRZLBVSQZYTRZLBVBQKBGNZLBVBQVL
    8
    DRZLBVSQGGQRZLBVBQKSDNZLBVBQVN
    9
    GVYNBVBQGDTVYNBVBQRLGLYNBVBQQD


    Game Shark Codes

    Note: You must have a 2.1 or higher version of the Game Shark to use these codes in a Game Boy Color system.

    Infinite Lives010AABC1
    Infinite Health0163A9C1


  • X
    "Like" CheatCC on Facebook